PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G07060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 315aa    MW: 32548.3 Da    PI: 8.7178
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G07060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  LPERR09G07060.1 14 KGPWTPEEDLMLVSYIQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.32.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  LPERR09G07060.1  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.83961IPR017930Myb domain
SuperFamilySSF466894.49E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002494.8E-161461IPR001005SANT/Myb domain
CDDcd001671.22E-111661No hitNo description
PROSITE profilePS5129424.72262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2465117IPR009057Homeodomain-like
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002495.2E-1567112IPR001005SANT/Myb domain
CDDcd001671.02E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYIQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKIQ  120
AAGGGEDGGG SVKAASAPKG QWERRLQTDI HTARQALRDA LSLDASPSPS PAKPTAAAAT  180
ATPAGSASAA YASSADNIAR LLQGWMRPGS GGGGGGGAKG PEASGSTSTT TNQQPQCSGE  240
GAASASASQS GGAGGNAAAA KTPEGSTETS KMAGGGGNAP AFSMLESWLL DDGGMGHGEV  300
GLMDVVPLGD PSEFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-26141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519141e-137JF951914.1 Aegilops tauschii clone TaMYB31 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652703.11e-162PREDICTED: myb-related protein 306-like
SwissprotP813921e-113MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D9XDP80.0A0A0D9XDP8_9ORYZ; Uncharacterized protein
STRINGGRMZM2G045748_P011e-161(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.24e-94myb domain protein 96